NKAP Polyclonal antibody

• 

  WB analysis using 27437-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27437-1-AP (NKAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NKAP Polyclonal Antibody for WB, ELISA

Cat No. 27437-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NF kappa B activating protein, NFKB activating protein, NKAP

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27437-1-AP targets NKAP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26637

  Product name: Recombinant human NKAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC015354

  Sequence: MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKER

• Full Name: NFKB activating protein
• Calculated Molecular Weight: 415 aa, 47 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC015354
• Gene Symbol: NKAP
• Gene ID (NCBI): 79576
• RRID: AB_3085959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5F7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NKAP is a multifunctional nuclear protein that is involved in the activation of the ubiquitous transcription factor NF-kappaB. NKAP is associated with the the histone deacetylase HDAC3 and with the Notch corepressor complex, and it thereby acts as a transcriptional repressor of Notch target genes. It is also required for alphabeta T cell development. A related pseudogene has been identified on chromosome X, while a related and intronless retrocopy, which has an intact CDS and may be functional, is located on chromosome 6.