NKAPL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NKAPL Polyclonal antibody (26993-1-AP)

• 

  WB analysis using 26993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26993-1-AP (NKAPL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26993-1-AP (NKAPL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

NKAPL Polyclonal Antibody for WB, ELISA

Cat No. 26993-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C6orf194, NFKB activating protein like, NKAP like protein

---

Tested Applications

• Positive WB detected in: mouse testis tissue, NTERA-2 cl.D1 cells, rat testis tissue, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26993-1-AP targets NKAPL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25779

  Product name: Recombinant human NKAPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-275 aa of BC101685

  Sequence: YSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTM

• Full Name: NFKB activating protein-like
• Observed Molecular Weight: 52 kDa, 65 kDa
• GenBank Accession Number: BC101685
• Gene Symbol: NKAPL
• Gene ID (NCBI): 222698
• RRID: AB_3742208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5M9Q1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NKAPL (NF-kappa-B activating protein-like), also known as C6orf194, is a nuclear protein-coding gene located on chromosome 6p22.1. Initially identified as a germ cell-specific suppressor of Notch signaling essential for spermatogenesis, NKAPL has recently emerged as a tumor suppressor in non-small cell lung cancer through TRIM21 stabilization and NF-κB pathway inhibition. Additionally, NKAPL promoter methylation serves as a prognostic biomarker in multiple malignancies.(PMID: 25875095; 40605974)