NKG7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NKG7 Polyclonal antibody, PBS Only (11532-1-PBS)

• 

  WB analysis using 11532-1-AP (same clone as 11532-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11532-1-AP (NKG7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11532-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NK-92 using 11532-1-AP (same clone as 11532-1-PBS)

  IP result of anti-NKG7 (IP:11532-1-AP, 4ug; Detection:11532-1-AP 1:1000) with NK-92 cells lysate 1120 ug. This data was developed using the same antibody clone with 11532-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11532-1-AP (same clone as 11532-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11532-1-AP (NKG7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11532-1-PBS in a different storage buffer formulation.

NKG7 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11532-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

G CSF induced gene 1 protein, G-CSF-induced gene 1 protein, GIG 1 protein, GIG1, GIG-1 protein

---

Product Information

11532-1-PBS targets NKG7 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2117

  Product name: Recombinant human NKG7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC015759

  Sequence: MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL

• Full Name: natural killer cell group 7 sequence
• Calculated Molecular Weight: 165 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC015759
• Gene Symbol: NKG7
• Gene ID (NCBI): 4818
• RRID: AB_3741818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16617
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Natural killer cell granule protein 7 (NKG7) regulates lymphocyte granule exocytosis and downstream inflammation in a broad range of diseases. NKG7 expressed by CD4+ and CD8+ T cells were key in promoting inflammation during visceral leishmaniasis and malaria-two important parasitic diseases. It is expressed by natural killer cells and is critical for controlling cancer initiation, growth, and metastasis (PMID: 32839608; 8458737). In brief, NKG7 is a necessary T-cell intrinsic factor for the cytotoxic function of CD8+ T cells and established NKG7 as a new therapeutic target for cancer immunotherapy (PMID: 34911739).