NKX2-4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NKX2-4 Polyclonal antibody (33052-1-AP)

• 

  WB analysis of HEK-293 using 33052-1-AP

  WB result of NKX2-4 antibody (33052-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-NKX2-4 transfected HEK-293 cells.

• 

  WB analysis using 33052-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33052-1-AP (NKX2-4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 33052-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using NKX2-4 antibody (33052-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• KD/KO Validated

NKX2-4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33052-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Homeobox protein NK-2 homolog D, Homeobox protein Nkx-2.4, NKX2D

---

Tested Applications

• Positive WB detected in: HEK-293 cells, THP-1 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33052-1-AP targets NKX2-4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37291

  Product name: Recombinant human NKX2-4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 288-354 aa of NM_033176

  Sequence: QNGASTPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLYGRTW

• Full Name: NK2 homeobox 4
• Calculated Molecular Weight: 36kDa
• Observed Molecular Weight: 38-41 kDa
• GenBank Accession Number: NM_033176
• Gene Symbol: NKX2-4
• Gene ID (NCBI): 644524
• RRID: AB_3742839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H2Z4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The NKX2-4 protein (full name: NK2 homeobox 4) belongs to the NK-2 type homeobox transcription factor family. Its main function is to act as a potential transcription factor, binding specifically to DNA sequences via its homeodomain and participating in the regulation of cell differentiation and the development of multicellular organisms. Studies have shown that this protein is active in the nucleus, and its aberrant expression may contribute to the development of acute myeloid leukemia by interfering with the normal differentiation of megakaryocytes and erythrocytes. Additionally, it can regulate the expression of genes such as TERT through allele-specific binding, thereby influencing tumor susceptibility in melanoma.