Tested Applications
| Positive WB detected in | LNCaP cells, human testis tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13069-1-AP targets NKX3.1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4070 Product name: Recombinant human NKX3-1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC074864 Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW Predict reactive species |
| Full Name | NK3 homeobox 1 |
| Calculated Molecular Weight | 234 aa, 26 kDa |
| Observed Molecular Weight | 34-38 kDa |
| GenBank Accession Number | BC074864 |
| Gene Symbol | NKX3-1 |
| Gene ID (NCBI) | 4824 |
| RRID | AB_10640580 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99801 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NKX3-1, also named as NKX3.1 and NKX3A, belongs to the NK-3 homeobox family. It is a transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. NKX3-1 plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. It act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells(PMID:19462257). The calcualted molecular weight of NKX3-1 is 26 kDa, but modified NKX3-1 is about 32-35 kDa. (PMID: 18597829)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NKX3.1 antibody 13069-1-AP | Download protocol |
| WB protocol for NKX3.1 antibody 13069-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NKX3.1 Polyclonal antibody (catalog 13069-1-AP) has 4 total citations. These appear in the Journal of Pathology, Scientific Reports, Prostate, and bioRxiv. The associated research fields center on prostate biology and disease, including lower urinary tract fibrosis, age-related and lobe-specific androgen receptor signaling in mice, c-Kit-mediated PI3K/AKT and Wnt/β-catenin signaling in benign prostatic hyperplasia, and ERG-driven stem-like proliferation in prostate epithelial cells. Cited applications are primarily IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Sci Rep Prostatic androgen receptor signaling shows an age-related and lobe-specific alteration in mice | ||
Prostate c-Kit-Mediated PI3K/AKT and Wnt/β-Catenin Signaling Drives Resistance to 5α-Reductase Inhibitors in Benign Prostatic Hyperplasia | ||
bioRxiv ERG activates a stem-like proliferation-differentiation program in prostate epithelial cells with mixed basal-luminal identity |
Reviews
What customers say
The antibody performed well for both immunohistochemistry and immunofluorescence on FFPE prostate tissue, with the primary applied at 1:500 for 1 hour at room temperature. While some background was noted as difficult to avoid, luminal prostate nuclei were clearly marked. The reviewer rated it 4 out of 5.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Parmveer (Verified Customer) (08-28-2019) | Worked well for both immunohistochemistry and immunofluorescence. FFPE prostate tissue used, primary applied for 1 hour at room temperature. There is a bit of background that is hard to avoid, but luminal prostate nuclei are clearly marked.
 |
