NKX3-1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of LNCaP using 86085-1-RR (same clone as 86085-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 86085-1-RR (NKX3-1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86085-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86085-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86085-1-RR against Human NKX3-1 were performed. The affinity constant is 0.411 nM.

NKX3-1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86085-1-PBS

Clone No.250402B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BAPX2, Homeobox protein NK-3 homolog A, Homeobox protein Nkx 3.1, Homeobox protein Nkx-3.1, NK3 homeobox 1

---

Product Information

86085-1-PBS targets NKX3-1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4070

  Product name: Recombinant human NKX3-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC074864

  Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

• Full Name: NK3 homeobox 1
• Calculated Molecular Weight: 234 aa, 26 kDa
• Observed Molecular Weight: 34-38 kDa
• GenBank Accession Number: BC074864
• Gene Symbol: NKX3-1
• Gene ID (NCBI): 4824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99801
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NKX3-1, also named as NKX3.1 and NKX3A, belongs to the NK-3 homeobox family. It is a transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. NKX3-1 plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. It act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells(PMID:19462257). The calcualted molecular weight of NKX3-1 is 26 kDa, but modified NKX3-1 is about 32-35 kDa. (PMID: 18597829)