NLGN4X Polyclonal antibody

• 

  WB analysis using 27278-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27278-1-AP (NLGN4X antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 27278-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27278-1-AP (NLGN4X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27278-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27278-1-AP (NLGN4X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NLGN4X Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27278-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

ASPGX2, AUTSX2, HLNX, HNLX, neuroligin 4, X linked

---

Tested Applications

• Positive WB detected in: human brain tissue, mouse brain tissue, rat brain tissue, pig brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27278-1-AP targets NLGN4X in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2426

  Product name: Recombinant human NLGN4X protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 469-816 aa of BC034018

  Sequence: FYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV

• Full Name: neuroligin 4, X-linked
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC034018
• Gene Symbol: NLGN4X
• Gene ID (NCBI): 57502
• RRID: AB_3085943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0W4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLGN4X is a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. NLGN4X has two isoforms with predicted MW's of 92 kDa and 94 kDa.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wojciech (Verified Customer) (03-25-2024)

Works well in human T cells lysates. Loaded 30 ug of protein. Blocked in 5% milk. Overnight incubation with primary antibody (1:500). Got a distinct band around ~90 kDa.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: T-ALL cell lines