NLRC5 Polyclonal antibody

• 

  WB analysis of THP-1 using 31067-1-AP

  IFN gamma treated THP-1 cells were subjected to SDS PAGE followed by western blot with 31067-1-AP (NLRC5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 31067-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 31067-1-AP (NLRC5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 31067-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 31067-1-AP (NLRC5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NLRC5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31067-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Caterpiller protein 16.1, CLR16.1, NOD27, NOD4

---

Tested Applications

• Positive WB detected in: IFN gamma treated THP-1 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31067-1-AP targets NLRC5 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34508

  Product name: Recombinant human NLRC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC063566

  Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR

• Full Name: NLR family, CARD domain containing 5
• Calculated Molecular Weight: 204 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC063566
• Gene Symbol: NLRC5
• Gene ID (NCBI): 84166
• RRID: AB_3669840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86WI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways.