NLRP12 Polyclonal antibody

• 

NLRP12 Polyclonal Antibody for IHC, ELISA

Cat No. 13417-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

CLR19.3, FCAS2, Monarch 1, NALP12, NLRP12, PAN6, PYPAF7, Regulated by nitric oxide, RNO, RNO2

---

Product Information

13417-1-AP targets NLRP12 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4125

  Product name: Recombinant human NLRP12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 714-1061 aa of BC028069

  Sequence: NLIELSLYRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANKNLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALEDLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC

• Full Name: NLR family, pyrin domain containing 12
• Calculated Molecular Weight: 1061 aa, 120 kDa
• GenBank Accession Number: BC028069
• Gene Symbol: NLRP12
• Gene ID (NCBI): 91662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59046
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.