Tested Applications
| Positive WB detected in | A549 cells, human lung tissue |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15182-1-AP targets NLRP2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7167 Product name: Recombinant human NLRP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC001039 Sequence: MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE Predict reactive species |
| Full Name | NLR family, pyrin domain containing 2 |
| Calculated Molecular Weight | 121 kDa |
| Observed Molecular Weight | 105-110 kDa |
| GenBank Accession Number | BC001039 |
| Gene Symbol | NLRP2 |
| Gene ID (NCBI) | 55655 |
| RRID | AB_2298531 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NX02 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NLRP2 (NLR family pyrin domain containing 2) is a member of the Nod-like receptor (NLR) family, characterized by an N-terminal pyrin domain (PYD), a central NACHT domain, and C-terminal leucine-rich repeats (LRRs). Encoded on chromosome 19q13.42, NLRP2 is widely expressed across tissues, with particularly high levels in the placenta, lung, thymus, and notably in oocytes and early embryos. Functionally, NLRP2 has emerged as a pleiotropic regulator with seemingly context-dependent roles. It can modulate innate immune signaling by inhibiting NF-κB activation and interacting with components of the IKK complex, while also promoting caspase-1 activation and IL-1β secretion, suggesting a role in inflammasome assembly. Beyond immunity, NLRP2 is essential for female reproduction, functioning as a non-core component of the subcortical maternal complex (SCMC) critical for preimplantation embryonic development; its deficiency or mutation is associated with female infertility and embryonic developmental arrest. Although historically less studied than NLRP1 or NLRP3, emerging evidence implicates NLRP2 in diverse pathological contexts, including neuroinflammation, ischemic stroke, and kidney damage, underscoring its potential as a therapeutic target.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NLRP2 antibody 15182-1-AP | Download protocol |
| IP protocol for NLRP2 antibody 15182-1-AP | Download protocol |
| WB protocol for NLRP2 antibody 15182-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NLRP2 Polyclonal antibody (Cat# 15182-1-AP) has 13 citations. These appear in journals including Immunity, J Adv Res, J Neuroinflammation, Brain Behav Immun, Front Immunol, Biochem Pharmacol, Front Microbiol, Eur J Pharmacol, Structure, Eur J Immunol, Mol Cell Endocrinol, J Neuroimmunol, and Noro Psikiyatr Ars. Research fields span neuroinflammation, inflammasome signaling, Parkinson's and Alzheimer's disease, depression, diabetic kidney disease, breast cancer, antiviral immunity, and microbiology. Applications include WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
J Adv Res Luteolin as a novel therapeutic for diabetic kidney disease: Targeting the ADAM10-TREM2 pathway. | ||
J Neuroinflammation Targeting CB2R in astrocytes for Parkinson's disease therapy: unraveling the Foxg1-mediated neuroprotective mechanism through autophagy-mediated NLRP3 degradation | ||
Brain Behav Immun Kynurenine regulates NLRP2 inflammasome in astrocytes and its implications in depression.
| ||
Front Immunol Macrophage IL-1β contributes to tumorigenesis through paracrine AIM2 inflammasome activation in the tumor microenvironment | ||
Biochem Pharmacol Activation of NLRP2 in Triple-Negative Breast Cancer sensitizes chemotherapeutic therapy through facilitating hnRNPK function |
