NLRP2 Polyclonal antibody

• 

  WB analysis of A549 using 15182-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 15182-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 15182-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 15182-1-AP (NLRP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A549 using 15182-1-AP

  IP result of anti-NLRP2 (IP:15182-1-AP, 4ug; Detection:15182-1-AP 1:3000) with A549 cells lysate 920 ug.

• 

  IHC staining of human placenta using 15182-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15182-1-AP (NLRP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 15182-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15182-1-AP (NLRP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NLRP2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15182-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CLR19.9, NACHT, LRR and PYD domains-containing protein 2, NALP2, NBS1, Nucleotide-binding site protein 1

---

Tested Applications

• Positive WB detected in: A549 cells, human lung tissue
• Positive IP detected in: A549 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

15182-1-AP targets NLRP2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7167

  Product name: Recombinant human NLRP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC001039

  Sequence: MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE

• Full Name: NLR family, pyrin domain containing 2
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 105-110 kDa
• GenBank Accession Number: BC001039
• Gene Symbol: NLRP2
• Gene ID (NCBI): 55655
• RRID: AB_2298531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX02
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Immunol; Macrophage IL-1β contributes to tumorigenesis through paracrine AIM2 inflammasome activation in the tumor microenvironment; Authors - Zhi Huan Chew
mouse	WB,IHC	Brain Behav Immun; Kynurenine regulates NLRP2 inflammasome in astrocytes and its implications in depression.; Authors - Qingyu Zhang ; KD Validated
human	WB	Eur J Immunol; NLRP2 negatively regulates antiviral immunity by interacting with TBK1.; Authors - Yanqing Yang ; KD Validated
human	IHC	Front Microbiol; Porphyromonas gingivalis-Induced NLRP3 Inflammasome Activation and Its Downstream Interleukin-1β Release Depend on Caspase-4.; Authors - Pei-Hui Ding
mouse	IHC	Mol Cell Endocrinol; Glucagon-like peptide-1 analogs mitigate neuroinflammation in Alzheimer's disease by suppressing NLRP2 activation in astrocytes; Authors - Mengjun Zhang
mouse	WB	J Neuroimmunol; A selective NLRP3 inflammasome inhibitor attenuates behavioral deficits and neuroinflammation in a mouse model of Parkinson's disease.; Authors - Shuxuan Huang