Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NLRP3 Polyclonal antibody

NLRP3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 27458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA, Immunohistochemistry

Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein, EC:3.6.4.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, THP-1 cells
Positive IP detected inTHP-1 cells
Positive IF/ICC detected inHepG2 cells

NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27458-1-AP targets NLRP3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA, Immunohistochemistry applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26272

Product name: Recombinant human NLRP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 937-1036 aa of NM_001079821

Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

Predict reactive species
Full Name NLR family, pyrin domain containing 3
Calculated Molecular Weight 118 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberNM_001079821
Gene Symbol NLRP3
Gene ID (NCBI) 114548
RRIDAB_2923578
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96P20
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa.

Protocols

Product Specific Protocols
IF protocol for NLRP3 antibody 27458-1-APDownload protocol
IP protocol for NLRP3 antibody 27458-1-APDownload protocol
WB protocol for NLRP3 antibody 27458-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis

Authors - Bin Liu
humanIF

Adv Sci (Weinh)

A Heparan Sulfate Mimetic RAFT Copolymer Inhibits SARS-CoV-2 Infection and Ameliorates Viral-Induced Inflammation

Authors - Jiaxin Ling
WB,IHC

J Physiol Pharmacol

Prodigiosin improves acute lung injury in a rat model of rheumatoid arthritis via down-regulating the nuclear factor kappaB/nucleotide-binding domain, leucine-rich-containing family, pyrin domain-containing-3 signaling pathway

Authors - P Chen
WB

Phytomedicine

Achyranthoside D attenuates chondrocyte loss and inflammation in osteoarthritis via targeted regulation of Wnt3a

Authors - Wenpeng Xie
WB,IF

Biomed Pharmacother

Protective role of hydrogen sulfide against diabetic cardiomyopathy by inhibiting pyroptosis and myocardial fibrosis

Authors - Maojun Liu
IF

Antioxidants (Basel)

Epimedium Aqueous Extract Ameliorates Cerebral Ischemia/Reperfusion Injury through Inhibiting ROS/NLRP3-Mediated Pyroptosis

Authors - Xiaoyu Wu
Loading...
||
New chat

Able

正在加载,请稍候...