NLRP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NLRP3 Polyclonal antibody, PBS Only (27458-1-PBS)

• 

  WB analysis using 27458-1-AP (same clone as 27458-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27458-1-AP (NLRP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27458-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 27458-1-AP (same clone as 27458-1-PBS)

  WB result of NLRP3 antibody (27458-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NLRP3 transfected THP-1 cells. This data was developed using the same antibody clone with 27458-1-PBS in a different storage buffer formulation.

• 

  IP experiment of THP-1 using 27458-1-AP (same clone as 27458-1-PBS)

  IP result of anti-NLRP3 (IP:27458-1-AP, 4ug; Detection:27458-1-AP 1:800) with THP-1 cells lysate 1520 ug. This data was developed using the same antibody clone with 27458-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27458-1-AP (same clone as 27458-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NLRP3 antibody (27458-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 27458-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NLRP3 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 27458-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein, EC:3.6.4.-

---

Product Information

27458-1-PBS targets NLRP3 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26272

  Product name: Recombinant human NLRP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 937-1036 aa of NM_001079821

  Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

• Full Name: NLR family, pyrin domain containing 3
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_001079821
• Gene Symbol: NLRP3
• Gene ID (NCBI): 114548
• RRID: AB_2923578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death(PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa.