NLRP3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00101-4

  Sandwich ELISA standard curve of MP00101-4, Human NLRP3 Recombinant Matched Antibody Pair - PBS only. 80422-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag26289. 80422-5-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP00101-4

  Saliva of eight individual healthy human donors was measured. The NLRP3 concentration of detected samples was determined to be 448.1 pg/mL with a range of 246.0-787.7 pg/mL.

• 

  Sample test of MP00101-4

  Serum of eight individual healthy human donors was measured. The NLRP3 concentration of detected samples was determined to be 263.1 pg/mL with a range of 100.1-572.7 pg/mL.

• 

  Cytometric bead array standard curve of MP80005-1

  Cytometric bead array standard curve of MP80005-1, NLRP3 Hybrid Matched Antibody Pair, PBS Only. Capture antibody: 80422-2-PBS. Detection antibody: 68102-3-PBS. Standard:Ag26289. Range: 1.563-25 ng/mL.

• 

  Affinity and Kinetic Characterization of 80422-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 80422-2-PBS against Human NLRP3 was performed. The affinity constant is 2.73 nM.

NLRP3 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 80422-2-PBS

Clone No.230052F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

230052F12, Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein

---

Product Information

80422-2-PBS targets NLRP3 as part of a matched antibody pair:

MP00101-4: 80422-2-PBS capture and 80422-5-PBS detection (validated in Sandwich ELISA)

MP80005-1: 80422-2-PBS capture and 68102-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26289

  Product name: Recombinant human NLRP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 937-1036 aa of NM_001079821

  Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

• Full Name: NLR family, pyrin domain containing 3
• Calculated Molecular Weight: 118 kDa
• GenBank Accession Number: NM_001079821
• Gene Symbol: NLRP3
• Gene ID (NCBI): 114548
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96P20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.