Mouse NLRP3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85967-1-RR (same clone as 85967-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85967-1-RR (NLRP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85967-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85967-1-RR (same clone as 85967-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85967-1-RR (NLRP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85967-1-PBS in a different storage buffer formulation.

• 

  IP experiment of RAW 264.7 using 85967-1-RR (same clone as 85967-1-PBS)

  IP result of anti-NLRP3 (IP:85967-1-RR, 4ug; Detection:85967-1-RR 1:1500) with RAW 264.7 cells lysate 1680 ug. This data was developed using the same antibody clone with 85967-1-PBS in a different storage buffer formulation.

NLRP3 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 85967-1-PBS

Clone No.250083C8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

AGTAVPRL, AII/AVP, Mmig1, MWS, NALP3

---

Product Information

85967-1-PBS targets NLRP3 in WB, IP, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32515

  Product name: Recombinant mouse NLRP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of NM_145827

  Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

• Full Name: NLR family, pyrin domain containing 3
• Calculated Molecular Weight: 118kd
• Observed Molecular Weight: 108-120 kDa
• GenBank Accession Number: NM_145827
• Gene Symbol: Nlrp3
• Gene ID (NCBI): 216799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8R4B8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death (PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa. An additional 130-135 kDa band could also be detected (PMID: 17164409; PMID: 34680443; PMID: 35585627). This antibody is specific for mouse NLRP3.