NLRP4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NLRP4 Polyclonal antibody (32694-1-AP)

• 

  WB analysis using 32694-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32694-1-AP (NLRP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 32694-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32694-1-AP (NLRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 32694-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32694-1-AP (NLRP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NLRP4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32694-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

NALP4, PAN2, PYPAF4, RNH2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32694-1-AP targets NLRP4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38545

  Product name: Recombinant human NLRP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-200 aa of NM_134444.4

  Sequence: LMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIHLYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRDRFLYTFYFCCRELRELPPTS

• Full Name: NLR family, pyrin domain containing 4
• Calculated Molecular Weight: 113kDa，994aa
• Observed Molecular Weight: 98-105 kDa
• GenBank Accession Number: NM_134444.4
• Gene Symbol: NLRP4
• Gene ID (NCBI): 147945
• RRID: AB_3742711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96MN2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NLRP4 is a member of the NOD-like receptor (NLR) family, a group of intracellular pattern recognition receptors (PRRs) that play crucial roles in innate immunity, inflammation, and cell death regulation.