NLRP6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NLRP6 Polyclonal antibody (30973-1-AP)

• 

  WB analysis using 30973-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30973-1-AP (NLRP6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30973-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30973-1-AP (NLRP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse colon using 30973-1-AP

  IP result of anti-NLRP6 (IP:30973-1-AP, 4ug; Detection:30973-1-AP 1:1500) with mouse colon tissue lysate 1440 ug.

• 

  IHC staining of human colon cancer using 30973-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 30973-1-AP (NLRP6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 30973-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using NLRP6 antibody (30973-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NLRP6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 30973-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

NALP6, PYPAF5

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue, mouse colon tissue, rat colon tissue, rat small intestine tissue
• Positive IP detected in: mouse colon tissue
• Positive IHC detected in: human colon cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

30973-1-AP targets NLRP6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34516

  Product name: Recombinant human NLRP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_138329.2

  Sequence: MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDEEGRRPLTVVL

• Full Name: NLR family, pyrin domain containing 6
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 98-105 kDa
• GenBank Accession Number: NM_138329.2
• Gene Symbol: NLRP6
• Gene ID (NCBI): 171389
• RRID: AB_3669800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59044
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOD-like receptor family pyrin domain containing 6 (NLRP6) is also named as NACHT, LRR and PYD domains-containing protein 6 and ZFML, Angiotensin II/vasopressin receptor, NALP6 and PYPAF5. NLRP6 forms a complex with ASC and caspase-1 or caspase-11 to form an inflammasome complex cleaving pro-interleukin-1β (IL-1β) and IL-18 into their biologically active forms. The function of NLRP6 has been attributed to the maintenance of epithelial integrity and host defense against microbial infections (PMID: 33910012). NLRP6 is reported to involved in inflammasome activation, regulation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinase (MAPK) signaling, antiviral interferon (IFN) signaling, mucus secretion, and antimicrobial peptide (AMP) production. NLRP6 is a novel NLR family member, that shows high expression in the intestine and liver (in contrast to NLRP3 in myeloid cells), to regulate inflammation and host defense against microbes (PMID: 32386845).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	J Inflamm Res; Integrated Single-Cell and Transcriptome Analysis with Experimental Validation Reveals PANoptosis-Related Gene Signatures in the Immune Microenvironment of Autoimmune Thyroiditis; Authors - Zhuo Zhao
		Cell Host Microbe; UBE2O-mediated monoubiquitination licenses NLRP6 inflammasome activation in the intestine; Authors - Decai Wang
mouse	WB	Nat Immunol; Cytosolic CTH senses bacterial lipoproteins and drives noncanonical inflammasome activation.; Authors - Qiannv Liu ; KO Validated