NLRP6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse colon using 83555-5-RR (same clone as 83555-5-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 83555-5-RR (NLRP6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83555-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 83555-5-RR (same clone as 83555-5-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using NLRP6 antibody (83555-5-RR, Clone: 240543B2 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83555-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83555-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83555-5-RR against Human NLRP6 were performed. The affinity constant is 3.65 nM.

NLRP6 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 83555-5-PBS

Clone No.240543B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

PYPAF5, NALP6, 240543B2

---

Product Information

83555-5-PBS targets NLRP6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34516

  Product name: Recombinant human NLRP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_138329.2

  Sequence: MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDEEGRRPLTVVL

• Full Name: NLR family, pyrin domain containing 6
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: NM_138329.2
• Gene Symbol: NLRP6
• Gene ID (NCBI): 171389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P59044
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NOD-like receptor family pyrin domain containing 6 (NLRP6) is also named as NACHT, LRR and PYD domains-containing protein 6 and ZFML, Angiotensin II/vasopressin receptor, NALP6 and PYPAF5. NLRP6 forms a complex with ASC and caspase-1 or caspase-11 to form an inflammasome complex cleaving pro-interleukin-1β (IL-1β) and IL-18 into their biologically active forms. The function of NLRP6 has been attributed to the maintenance of epithelial integrity and host defense against microbial infections (PMID: 33910012). NLRP6 is reported to involved in inflammasome activation, regulation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinase (MAPK) signaling, antiviral interferon (IFN) signaling, mucus secretion, and antimicrobial peptide (AMP) production. NLRP6 is a novel NLR family member, that shows high expression in the intestine and liver (in contrast to NLRP3 in myeloid cells), to regulate inflammation and host defense against microbes (PMID: 32386845).