NME1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85038-7-RR (same clone as 85038-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85038-7-RR (NME1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85038-7-PBS in a different storage buffer formulation.

• 

  WB analysis using 85038-7-RR (same clone as 85038-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85038-7-RR (NME1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85038-7-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 85038-7-RR (same clone as 85038-7-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using NME1 antibody (85038-7-RR, Clone: 242670D5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85038-7-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 85038-7-RR (same clone as 85038-7-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NME1 Recombinant antibody (85038-7-RR, Clone:242670D5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 85038-7-PBS in a different storage buffer formulation.

NME1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85038-7-PBS

Clone No.242670D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

242670D5, AWD, EC:2.7.4.6, GAAD, Granzyme A activated DNase

---

Product Information

85038-7-PBS targets NME1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1548

  Product name: Recombinant human NME1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC018994

  Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

• Full Name: non-metastatic cells 1, protein (NM23A) expressed in
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC018994
• Gene Symbol: NME1
• Gene ID (NCBI): 4830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15531
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination. It has 3 isoforms produced by alternative splicing. Refer to the epitope and protein detection, this antibody specifically recognizes NME1.