NME2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85074-4-RR (same clone as 85074-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85074-4-RR (NME2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85074-4-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 85074-4-RR (same clone as 85074-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using NME2 antibody (85074-4-RR, Clone: 242698C3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85074-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293T using 85074-4-RR (same clone as 85074-4-PBS)

  1x10^6 HEK-293T cells were intracellularly stained with 0.13 ug NME2 Recombinant antibody (85074-4-RR, Clone:242698C3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.13 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 85074-4-PBS in a different storage buffer formulation.

NME2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85074-4-PBS

Clone No.242698C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

242698C3, C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6, Histidine protein kinase NDKB

---

Product Information

85074-4-PBS targets NME2 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13913

  Product name: Recombinant human NME2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC002476

  Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

• Full Name: non-metastatic cells 2, protein (NM23B) expressed in
• Calculated Molecular Weight: 152 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC002476
• Gene Symbol: NME2
• Gene ID (NCBI): 4831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22392
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. Refer to the epitope and protein detection, this antibody specifically recognizes NME2.