NME4 Polyclonal antibody

• 

NME4 Polyclonal Antibody for ELISA

Cat No. 18348-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

NDK, NDP kinase, mitochondrial, NDPK D, NDPKD, NME4

---

Published Applications

• WB: See 1 publications below

Product Information

18348-1-AP targets NME4 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13162

  Product name: Recombinant human NME4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC004880

  Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

• Full Name: non-metastatic cells 4, protein expressed in
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC004880
• Gene Symbol: NME4
• Gene ID (NCBI): 4833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00746
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Environ Pollut; Proteomic profile in Perna viridis after exposed to Prorocentrum lima, a dinoflagellate producing DSP toxins.; Authors - Lu Huang