NME7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NME7 Polyclonal antibody, PBS Only (26449-1-PBS)

• 

  WB analysis of mouse embryo using 26449-1-AP (same clone as 26449-1-PBS)

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 26449-1-AP (NME7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26449-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 26449-1-AP (same clone as 26449-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26449-1-AP (NME7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26449-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 26449-1-AP (same clone as 26449-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26449-1-AP (NME7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26449-1-PBS in a different storage buffer formulation.

NME7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26449-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26449-1-PBS targets NME7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24918

  Product name: Recombinant human NME7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC006983

  Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR

• Full Name: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
• Calculated Molecular Weight: 376 aa, 42 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC006983
• Gene Symbol: NME7
• Gene ID (NCBI): 29922
• RRID: AB_2880517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5B8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NME7, also named as NDK7, nm23-H7, plays the major role in the synthesis of nucleoside triphosphates other than ATP. NME7 has two isoforms with MW 38-42 kDa.