NMI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NMI Polyclonal antibody, PBS Only (31096-1-PBS)

• 

  WB analysis using 31096-1-AP (same clone as 31096-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31096-1-AP (NMI antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 31096-1-AP (same clone as 31096-1-PBS)

  WB result of NMI antibody (31096-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NMI transfected HeLa cells. This data was developed using the same antibody clone with 31096-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NMI Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31096-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

N myc (and STAT) interactor, N myc and STAT interactor, N myc interactor, N-myc and STAT interactor, N-myc-interactor

---

Product Information

31096-1-PBS targets NMI in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34759

  Product name: Recombinant human NMI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC001268

  Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI

• Full Name: N-myc (and STAT) interactor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001268
• Gene Symbol: NMI
• Gene ID (NCBI): 9111
• RRID: AB_3669853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13287
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis.