NO66/C14orf169 Polyclonal antibody

• 

  WB analysis using 22842-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22842-1-AP (NO66/C14orf169 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 22842-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22842-1-AP (NO66/C14orf169 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 22842-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 22842-1-AP (NO66/C14orf169 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 22842-1-AP

  IP result of anti-NO66/C14orf169 (IP:22842-1-AP, 4ug; Detection:22842-1-AP 1:500) with Jurkat cells lysate 4000ug.

NO66/C14orf169 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22842-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

C14orf169, hsNO66, MAPJD, NO66, NO66/C14orf169, Nucleolar protein 66

---

Tested Applications

• Positive WB detected in: A431 cells, Jurkat cells, NCCIT cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22842-1-AP targets NO66/C14orf169 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18721

  Product name: Recombinant human C14orf169 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 296-640 aa of BC011350

  Sequence: LRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLAL

• Full Name: chromosome 14 open reading frame 169
• Calculated Molecular Weight: 641 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC011350
• Gene Symbol: NO66
• Gene ID (NCBI): 79697
• RRID: AB_2879175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9H6W3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NO66, also known as C14orf169 and MAPJD, is a JmjC domain-containing oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. NO66 is highly conserved during evolution and shows a dual localization pattern, present in both the nucleoplasm and nucleolus (PMID: 14742713). It has been reported that NO66 participates in regulation of Osx transcriptional activity and plays an important role in osteoblast differentiation through interaction with Osx (PMID: 19927124; 23620590). Through interaction with MYC protein, NO66 plays a role in pulmonary carcinogenesis (PMID: 17308053).