NOL11 Polyclonal antibody

• 

  WB analysis using 17613-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17613-1-AP (NOL11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

NOL11 Polyclonal Antibody for WB, ELISA

Cat No. 17613-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

L14, NOL11, nucleolar protein 11

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17613-1-AP targets NOL11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11783

  Product name: Recombinant human NOL11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC064404

  Sequence: MAALEEEFTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNLDKVFKATLSAEVYRILSVQGTEPLVLFKEGAVRGLEALLADPQQKIETVISDEEVIKWTKFFVVFRHPVLIFITEKHGNYFAYVQMFNSRILTKYTLLLGQDENSVIKSFTASVDRKFISLMSLSSDGCIYETLIPIRPADPEKNQSLVKSLLLKAVVSGNARNGVALTALDQDHVAVLGSPLAASKECLSVWNIKFQTLQTSKELPQGTSGQLWYYGEHLFMLHGKSLTVIPYKCEVSSLAGALGKLKHSQDP

• Full Name: nucleolar protein 11
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 75-81 kDa
• GenBank Accession Number: BC064404
• Gene Symbol: NOL11
• Gene ID (NCBI): 25926
• RRID: AB_3085529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8H0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOL11, also named as L14, is a ribosome biogenesis factor. It is required for both optimal rDNA transcription and small subunit (SSU) pre-rRNA processing at sites A', A0, 1 and 2b. NOL11 forms a protein complex with two tryptophan-aspartic acid (WD) repeat proteins named WD-repeat protein 43 (WDR43) and Cirhin in mitotic cells. NOL11 plays a role in pathogenesis of NAIC. There're some isoforms with MW 81 kDa and 19 kDa.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wojciech (Verified Customer) (11-05-2025)

Detected a weak band at 75 kDa in T-cells (1:1000).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: T-cells