NOL12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NOL12 Polyclonal antibody, PBS Only (15456-1-PBS)

• 

  WB analysis using 15456-1-AP (same clone as 15456-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15456-1-AP (NOL12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15456-1-AP (same clone as 15456-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15456-1-AP (NOL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 15456-1-AP (same clone as 15456-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15456-1-AP (NOL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15456-1-AP (same clone as 15456-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15456-1-AP (NOL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 15456-1-AP (same clone as 15456-1-PBS)

  IP result of anti-NOL12 (IP:15456-1-AP, 4ug; Detection:15456-1-AP 1:300) with HeLa cells lysate 4000ug. This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15456-1-AP (same clone as 15456-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NOL12 antibody (15456-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15456-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NOL12 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 15456-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15456-1-PBS targets NOL12 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7723

  Product name: Recombinant human NOL12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC002808

  Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE

• Full Name: nucleolar protein 12
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC002808
• Gene Symbol: NOL12
• Gene ID (NCBI): 79159
• RRID: AB_2282718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGY1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nucleolar protein 12 (NOL12), a multifunctional RNA-binding protein, has been found to be related to genomic stability, DNA damage repair, and apoptosis. High expression of NOL12 is associated with worse reduced overall survival (OS), high pathological grade, node metastasis, and advanced clinical stage in patients with HCC (PMID: 35693698). Knockdown of NOL12 impairs cellular proliferation by inducing a G1/S cell cycle arrest, but does so outside of a nucleolar stress response and in a p53-independent manner (PMID: 29069457).