NOMO1 Polyclonal antibody

• 

  WB analysis of mouse colon using 17792-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 17792-1-AP (NOMO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 17792-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17792-1-AP (NOMO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 17792-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 17792-1-AP (NOMO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17792-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17792-1-AP (NOMO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 17792-1-AP

  IP result of anti-NOMO1 (IP:17792-1-AP, 4ug; Detection:17792-1-AP 1:1000) with A431 cells lysate 1520ug.

• 

  IHC staining of human colon using 17792-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 17792-1-AP (NOMO1 Antibody) at dilution of 1:50.

• 

  IHC staining of human colon cancer using 17792-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17792-1-AP (NOMO1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 17792-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 17792-1-AP (NOMO1 Antibody) at dilution of 1:50.

• 

  IHC staining of human pancreas using 17792-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 17792-1-AP (NOMO1 Antibody) at dilution of 1:50.

• 

  IHC staining of human pancreas using 17792-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 17792-1-AP (NOMO1 Antibody) at dilution of 1:50.

• 

  IF Staining of MCF-7 using 17792-1-AP

  Immunofluorescent analysis of MCF-7 cells, using NOMO1 antibody 17792-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

NOMO1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17792-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

pM5 protein, PM5, Nomo, Nodal modulator 1, BOS complex subunit NOMO1

---

Tested Applications

• Positive WB detected in: mouse colon tissue, A431 cells, COLO 320 cells, human brain tissue
• Positive IP detected in: A431 cells
• Positive IHC detected in: human colon cancer tissue, human colon tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

17792-1-AP targets NOMO1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11895

  Product name: Recombinant human NOMO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 873-1222 aa of BC065535

  Sequence: YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRVLGQAASDNSGPEDAKRQAKKQKTRRT

• Full Name: NODAL modulator 1
• Calculated Molecular Weight: 1222 aa, 134 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC065535
• Gene Symbol: NOMO1
• Gene ID (NCBI): 23420
• RRID: AB_2152031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15155
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Clin Sci (Lond); DLX3 promotes bone marrow mesenchymal stem cell proliferation through H19/miR-675 axis.; Authors - Na Zhao