NOMO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NOMO2 Polyclonal antibody (14328-1-AP)

NOMO2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14328-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BOS complex subunit NOMO2, Nodal modulator 2, pM5 protein 2

• 

  WB analysis of BxPC-3 using 14328-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14328-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14328-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 14328-1-AP

  IP result of anti-NOMO2 (IP:14328-1-AP, 4ug; Detection:14328-1-AP 1:1000) with HEK-293 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 14328-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14328-1-AP (NOMO2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 14328-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14328-1-AP (NOMO2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of BxPC-3 using 14328-1-AP

  Immunofluorescent analysis of BxPC-3 cells using 14328-1-AP (NOMO2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HEK-293 cells, HL-60 cells, HepG2 cells, THP-1 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14328-1-AP targets NOMO2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5595

  Product name: Recombinant human NOMO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 873-1222 aa of BC041131

  Sequence: YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRRT

• Full Name: NODAL modulator 2
• Calculated Molecular Weight: 139 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC041131
• Gene Symbol: NOMO2
• Gene ID (NCBI): 283820
• RRID: AB_2152154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JPE7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Biol Ther; Radiotherapy diagnostic biomarkers in radioresistant human H460 lung cancer stem-like cells.; Authors - Hong Shik Yun
human	WB	bioRxiv; The ER membrane protein complex acts as a chaperone to promote the biogenesis of multi-bundle membrane proteins.; Authors - Marinda Stanton
human	WB	Mol Cell; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins.; Authors - Katharine R. Page ; KD Validated