Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, Jurkat cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22769-1-AP targets NOP10 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18718 Product name: Recombinant human NOP10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC063023 Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Predict reactive species |
| Full Name | NOP10 ribonucleoprotein homolog (yeast) |
| Calculated Molecular Weight | 64 aa, 77 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC063023 |
| Gene Symbol | NOP10 |
| Gene ID (NCBI) | 55505 |
| RRID | AB_3742080 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9NPE3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NOP10 antibody 22769-1-AP | Download protocol |
| WB protocol for NOP10 antibody 22769-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The single review reports excellent performance for Western blot. The antibody was used at a 1:4000 dilution on mouse embryonic fibroblasts and produced strong, reliable results. The reviewer rated it 5 out of 5 stars, indicating high satisfaction with the product's specificity and performance in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Silvia (Verified Customer) (10-06-2025) | This antibody worked very well for western blot (mouse fibroblasts)
|
