NOP10 Polyclonal antibody

NOP10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22769-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

NOP10P, NOP 10, NOLA3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 22769-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22769-1-AP (NOP10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 22769-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22769-1-AP (NOP10 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 22769-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22769-1-AP (NOP10 antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	COLO 320 cells, HeLa cells, Jurkat cells
Positive IHC detected in	human pancreas cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22769-1-AP targets NOP10 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18718 Product name: Recombinant human NOP10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC063023 Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Predict reactive species
Full Name	NOP10 ribonucleoprotein homolog (yeast)
Calculated Molecular Weight	64 aa, 77 kDa
Observed Molecular Weight	10-12 kDa
GenBank Accession Number	BC063023
Gene Symbol	NOP10
Gene ID (NCBI)	55505
RRID	AB_3742080
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	Q9NPE3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).