NOP10 Polyclonal antibody

• 

  WB analysis using 22769-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22769-1-AP (NOP10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 22769-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22769-1-AP (NOP10 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 22769-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22769-1-AP (NOP10 antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NOP10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22769-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

NOP10P, NOP 10, NOLA3

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22769-1-AP targets NOP10 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18718

  Product name: Recombinant human NOP10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC063023

  Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

• Full Name: NOP10 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 64 aa, 77 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC063023
• Gene Symbol: NOP10
• Gene ID (NCBI): 55505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NPE3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Silvia (Verified Customer) (10-06-2025)

This antibody worked very well for western blot (mouse fibroblasts)

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: Mouse embryonic fibroblasts