NOP10 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NOP10 Recombinant monoclonal antibody, PBS Only (87529-1-PBS)

• 

  WB analysis using 87529-1-RR (same clone as 87529-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87529-1-RR (NOP10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human brain cancer（Astrocitoma） using 87529-1-RR (same clone as 87529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 87529-1-RR (NOP10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87529-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human brain cancer（Astrocitoma） using 87529-1-RR (same clone as 87529-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 87529-1-RR (NOP10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87529-1-PBS in a different storage buffer formulation.

NOP10 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87529-1-PBS

Clone No.252910G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

NOLA3, NOP 10, NOP10P

---

Product Information

87529-1-PBS targets NOP10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18718

  Product name: Recombinant human NOP10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC063023

  Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

• Full Name: NOP10 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 64 aa, 77 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC063023
• Gene Symbol: NOP10
• Gene ID (NCBI): 55505
• RRID: AB_3745601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPE3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).