• Featured Product
  • KD/KO Validated

NOP14 Polyclonal antibody

NOP14 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 26854-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

C4orf9, NOL14, Nucleolar protein 14, RES4 25, RES425

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-453s cells, BxPC-3 cells, MCF-7 cells, mouse lung tissue, rat kidney tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26854-1-AP targets NOP14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25476

Product name: Recombinant human NOP14 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-95 aa of BC026035

Sequence: MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNM

Predict reactive species
Full Name NOP14 nucleolar protein homolog (yeast)
Calculated Molecular Weight 98 kDa
Observed Molecular Weight 98 kDa
GenBank Accession NumberBC026035
Gene Symbol NOP14
Gene ID (NCBI) 8602
RRIDAB_2880657
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP78316
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for NOP14 antibody 26854-1-APDownload protocol
WB protocol for NOP14 antibody 26854-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IHC

Cell Prolif

CCND1, NOP14 and DNMT3B are involved in miR-502-5p-mediated inhibition of cell migration and proliferation in bladder cancer.

Authors - Yufan Ying
  • KD Validated
humanWB,IHC,IF

Aging (Albany NY)

Exploring Cancer Dependency Map genes and immune subtypes in colon cancer, in which TIGD1 contributes to colon cancer progression

Authors - Guoyang Zhang
humanWB

Int J Biol Macromol

CircNOP14 increases the radiosensitivity of hepatocellular carcinoma via inhibition of Ku70-dependent DNA damage repair

Authors - Letao Lin
humanWB,IHC

Front Biosci (Landmark Ed)

NOP14 as a Potential Predictor of Adult-Type Diffuse Glioma Prognosis and Immunotherapy, is Related to Cell Migration, Proliferation, and CD8+T Cell Infiltration

Authors - Qiu-Si Tian
Loading...
||
New chat Able
正在加载,请稍候...