NOP14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NOP14 Polyclonal antibody (26854-1-AP)

• Featured Product
• KD/KO Validated

NOP14 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26854-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C4orf9, NOL14, Nucleolar protein 14, RES4 25, RES425

• 

  WB analysis of MDA-MB-453s using 26854-1-AP

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BxPC-3 using 26854-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BxPC-3 using 26854-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 26854-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 26854-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 26854-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 26854-1-AP (NOP14 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26854-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 26854-1-AP (NOP14 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NOP14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MDA-MB-453s cells, BxPC-3 cells, MCF-7 cells, mouse lung tissue, rat kidney tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26854-1-AP targets NOP14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25476

  Product name: Recombinant human NOP14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-95 aa of BC026035

  Sequence: MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNM

• Full Name: NOP14 nucleolar protein homolog (yeast)
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC026035
• Gene Symbol: NOP14
• Gene ID (NCBI): 8602
• RRID: AB_2880657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78316
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The antibody targeting NOP14 (Cat# 26854-1-AP) has 8 total citations spanning journals including Nucleic Acids Research, International Journal of Oral Science, International Journal of Biological Macromolecules, Cell Proliferation, Frontiers in Immunology, Frontiers in Bioscience, Experimental Cell Research, and Aging. Research fields cover gut microbiome-pain modulation, HIV nucleolar stress, hepatocellular carcinoma DNA repair, bladder cancer migration, DLBCL tumor immunity, glioma prognosis, diabetic retinopathy Wnt signaling, and colon cancer immune subtypes.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Oral Sci; Single-cell multi-omics sequencing reveals cell-specific transcriptomic and chromatin accessibility profiles in gut microbiome metabolite butyrate-produced pain modulation.; Authors - Ran Tao
human	WB	Nucleic Acids Res; HIV Vpr activates a nucleolar-specific ATR pathway to degrade the nucleolar stress sensor CCDC137; Authors - Karly A Nisson
human	WB	Int J Biol Macromol; CircNOP14 increases the radiosensitivity of hepatocellular carcinoma via inhibition of Ku70-dependent DNA damage repair; Authors - Letao Lin
mouse,human	WB,IHC	Cell Prolif; CCND1, NOP14 and DNMT3B are involved in miR-502-5p-mediated inhibition of cell migration and proliferation in bladder cancer.; Authors - Yufan Ying ; KD Validated
		Front Immunol; Targeting NOP14 remodels the tumor immune microenvironment and enhances the antitumor efficacy of PD-1 blockade in DLBCL.; Authors - Lu Zou
human	WB,IHC	Front Biosci (Landmark Ed); NOP14 as a Potential Predictor of Adult-Type Diffuse Glioma Prognosis and Immunotherapy, is Related to Cell Migration, Proliferation, and CD8+T Cell Infiltration; Authors - Qiu-Si Tian