NOP16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NOP16 Polyclonal antibody, PBS Only (31969-1-PBS)

• 

  WB analysis using 31969-1-AP (same clone as 31969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31969-1-AP (NOP16 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31969-1-AP (same clone as 31969-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NOP16 antibody (31969-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 31969-1-AP (same clone as 31969-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NOP16 antibody (31969-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31969-1-PBS in a different storage buffer formulation.

NOP16 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31969-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

31969-1-PBS targets NOP16 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36714

  Product name: Recombinant human NOP16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC040106

  Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE

• Full Name: NOP16 nucleolar protein homolog (yeast)
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC040106
• Gene Symbol: NOP16
• Gene ID (NCBI): 51491
• RRID: AB_3670160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y3C1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NOP16, also known as HSPC111, is found in the intracellular protein complex. It is a ribosomal protein that is transcriptionally regulated by the oncogene c-Myc. NOP16 may be involved in the completion of ribosome synthesis, therefore, reduced NOP16 expression in cancer cells may block many biological processes. Studies indicate that NOP16 is highly expressed in more than 20 types of cancers, including colorectal, breast, and hepatocellular carcinoma, and is an important target for clinical treatment of related diseases.