NOP2 Monoclonal antibody, PBS Only

NOP2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68889-1-PBS
Clone No.1F4F4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Nucleolar protein 1, NSUN1, NOP120, NOL1, EC:2.1.1.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68889-1-PBS targets NOP2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33985

Product name: Recombinant human NOP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2-170 aa of BC000656

Sequence: GRKLDPTKEKRGPGRKARKQKGAETELVRFLPAVSDENSKRLSSRARKRAAKRRLGSVEAPKTNKSPEAKPLPGKLPKGISAGAVQTAGKKGPQSLFNAPRGKKRPAPGSDEEEEEEDSEEDGMVNHGDLWGSEDDADTVDDYGADSNSEDEEEGEALLPIERAARKQK

Predict reactive species
Full Name NOP2 nucleolar protein homolog (yeast)
Calculated Molecular Weight 120 kDa
Observed Molecular Weight100-120 kDa
GenBank Accession NumberBC000656
Gene Symbol NOP2
Gene ID (NCBI) 4839
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46087
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NOL1, (synonyms: p120, NSUN1, NOP120), is a 120 kDa proliferating-cell nucleolar antigen and is the most cancer specific of the proliferation-associated nucleolar proteins identified thus far. NOL1 is expressed in G1 and peaks during the early S phase of the cell cycle and it has not been detected in benign tumors and most normal resting tissues. Overexpression of NOL1 caused the transformation of NIH 3T3 cells and expression of an antisense NOL1 construct inhibited the growth of NIH 3T3 cells. NOL is localized in a novel nucleolar microfibrillar structure, and contains, consecutively, four major domains: a basic domain, an acidic domain, a hydrophobic and methionine-rich domain, and a domain rich in cysteine and proline residues. The gene for human NOL1 was assigned to chromosome 12p13 (PMID: 23775790).

Loading...
||
New chat Able
正在加载,请稍候...