NOP56 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NOP56 Polyclonal antibody (18181-1-AP)

NOP56 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18181-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

NOL5A, NOP 56

• 

  WB analysis of NIH/3T3 using 18181-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18181-1-AP (NOP56 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18181-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18181-1-AP (NOP56 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18181-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18181-1-AP (NOP56 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 18181-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18181-1-AP (NOP56 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 18181-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18181-1-AP (NOP56 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NOP56 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, A549 cells, HeLa cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18181-1-AP targets NOP56 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12882

  Product name: Recombinant human NOP56 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 246-594 aa of BC104791

  Sequence: DASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED

• Full Name: NOP56 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 594 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC104791
• Gene Symbol: NOP56
• Gene ID (NCBI): 10528
• RRID: AB_2152323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00567
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Box C/D RNA-protein complexes (RNPs) guide the 2'-O-methylation of nucleotides in eukaryotic ribosomal RNAs. The box C/D and C'/D' RNP subcomplexes are each assembled with three sRNP core proteins. The Nop56 core protein mediates crucial protein-protein interactions required for both sRNP assembly and the methyltransferase reaction by bridging the L7Ae and fibrillarin core proteins [PMID:22496443]. NOP56 is a component of the box C/D small nucleolar ribonucleoprotein complexes that direct 2-prime-O-methylation of pre-ribosomal RNA (rRNA) during its maturation. It is predicted to function in an early to middle step in pre-rRNA processing [PMID:12777385].

Publications

What published studies show

The NOP56 polyclonal antibody (Cat# 18181-1-AP) has 2 citations. One appears in International Journal of Biological Sciences (2021), studying a novel HDAC inhibitor's effect on ovarian cancer cell proliferation in human samples via WB. The other is in iScience (2020), investigating BMAL1's association with NOP58 in the nucleolus and its role in pre-rRNA processing in mouse models via WB. The associated research fields are cancer biology and RNA processing/nucleolar biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Biol Sci; Discovery of a novel HDACi structure that inhibits the proliferation of ovarian cancer cells in vivo and in vitro.; Authors - Miao Bai
mouse	WB	iScience; BMAL1 Associates with NOP58 in the Nucleolus and Contributes to Pre-rRNA Processing.; Authors - Marlene Cervantes