eNOS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• eNOS Polyclonal antibody (27120-1-AP)

eNOS Polyclonal Antibody for WB, ELISA

Cat No. 27120-1-AP Copied!

Publications (130)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

NOS3, cNOS, EC:1.14.13.39, ECNOS, EC-NOS

• 

  WB analysis using 27120-1-AP

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 27120-1-AP (eNOS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27120-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27120-1-AP (eNOS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 27120-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27120-1-AP (eNOS antibody) at dilution of 1:450 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for eNOS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: bEnd.3 cells, HUVEC cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27120-1-AP targets eNOS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25712

  Product name: Recombinant human NOS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of

  Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP

• Full Name: nitric oxide synthase 3 (endothelial cell)
• Observed Molecular Weight: 133 kDa, 69 kDa
• Gene Symbol: eNOS
• Gene ID (NCBI): 4846
• RRID: AB_2880764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29474
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine.

Publications

What published studies show

The anti-eNOS (NOS3) antibody (Cat# 27120-1-AP) has accumulated 130 total citations. Publications span journals such as Nature Communications, Circulation, Science Advances, Free Radical Biology and Medicine, European Journal of Pharmacology, and Journal of Advanced Research. Associated research fields include cardiovascular disease, endothelial dysfunction, atherosclerosis, hypertension, diabetes, wound healing, angiogenesis, inflammation, oxidative stress, and neuroprotection.

Automatically generated from the 130 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Circulation; Aberrant Phase Separation of Endothelial MAML1 Causes Congenital Heart Disease by Suppressing Notch Activity; Authors - Zizheng Tan
	WB	Nat Commun; Metabolomics and proteomics reveal blocking argininosuccinate synthetase 1 alleviates colitis in mice; Authors - Shijia Liu
mouse	IF	J Adv Res; Plasma-activated solutions prevent peritoneal adhesion formation by regulating eNOS expression in mesothelial cells; Authors - Yuyi Ma
mouse,human	WB	J Adv Res; OTUD1 delays wound healing by regulating endothelial function and angiogenesis in diabetic mice; Authors - Jiajia Zhang
mouse	WB	Redox Biol; Exercise protects aged mice against coronary endothelial senescence via FUNDC1-dependent mitophagy; Authors - Lijie Ma
mouse	WB	Redox Biol; Non-steroidal mineralocorticoid receptor antagonist finerenone ameliorates mitochondrial dysfunction via PI3K/Akt/eNOS signaling pathway in diabetic tubulopathy; Authors - Lan Yao