eNOS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of bEnd.3 using 85020-4-RR (same clone as 85020-4-PBS)

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 85020-4-RR (NOS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85020-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 85020-4-RR (same clone as 85020-4-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 85020-4-RR (NOS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85020-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85020-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85020-4-RR against Human NOS3 were performed. The affinity constant is 3.17 nM.

eNOS Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85020-4-PBS

Clone No.242543E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

NOS3, 242543E10, cNOS, EC:1.14.13.39, ECNOS

---

Product Information

85020-4-PBS targets eNOS in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25712

  Product name: Recombinant human NOS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of

  Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP

• Full Name: nitric oxide synthase 3 (endothelial cell)
• Observed Molecular Weight: 140 kDa
• Gene Symbol: eNOS
• Gene ID (NCBI): 4846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29474
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine.