NOSIP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NOSIP Polyclonal antibody (27979-1-AP)

• Featured Product
• KD/KO Validated

NOSIP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27979-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CGI 25, CGI-25, E3 ubiquitin-protein ligase NOSIP, EC:2.3.2.27, eNOS interacting protein

• 

  WB analysis using 27979-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27979-1-AP (NOSIP antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27979-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27979-1-AP (NOSIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 27979-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27979-1-AP (NOSIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 27979-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 27979-1-AP (NOSIP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 27979-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 27979-1-AP (NOSIP antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NOSIP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A431 cells, A549 cells, Ramos cells, HepG2 cells, L02 cells
• Positive IHC detected in: human colon tissue, human lung tissue, rat pancreas tissue, mouse pancreas tissue, rat kidney tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27979-1-AP targets NOSIP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27569

  Product name: Recombinant human NOSIP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-301 aa of BC010077

  Sequence: MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

• Full Name: nitric oxide synthase interacting protein
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC010077
• Gene Symbol: NOSIP
• Gene ID (NCBI): 51070
• RRID: AB_2881027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y314
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-NOSIP antibody (Cat# 27979-1-AP) has 3 total citations published in Nature Communications, Scientific Reports, and iScience. These citations span research fields including epigenetics (identification of epigenetic regulators at methylated genomic sites) and cancer biology (clear cell renal cell carcinoma and hepatocellular carcinoma), with applications in Western blot and immunohistochemistry.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Selective identification of epigenetic regulators at methylated genomic sites by SelectID; Authors - Wenchang Qian
		Sci Rep; NOSIP promotes cell proliferation and motility by targeting SPTAN1 for ubiquitination and degradation in clear cell renal cell carcinoma.; Authors - Ruoxue Cao
human	WB,IHC	iScience; Nosip is a potential therapeutic target in hepatocellular carcinoma cells; Authors - Junjie Gao ; KD Validated