• Featured Product
  • KD/KO Validated

NOTCH2 Recombinant monoclonal antibody, PBS Only

NOTCH2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84074-4-PBS
Clone No.241162A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

241162A2, hN2, N2ECD, N2ICD, Notch 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84074-4-PBS targets NOTCH2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29413

Product name: Recombinant human NOTCH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1697-1819 aa of NM_024408

Sequence: VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL

Predict reactive species
Full Name Notch homolog 2 (Drosophila)
Calculated Molecular Weight 265 kDa
Observed Molecular Weight 110 kDa, 265kDa
GenBank Accession NumberNM_024408
Gene Symbol NOTCH2
Gene ID (NCBI) 4853
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ04721
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NOTCH2 (Neurogenic locus notch homolog protein 2) belongs to the NOTCH family.. In kidney, previous reports demonstrated that Notch1 and Notch2 were activated in mammalian nephrogenesis (PMID: 24526233). Notch2 is expressed in many cell types of most lineages in the hematolymphoid compartment and has specific roles in differentiation and function of various immune cells. Notch2 is required for development of splenic marginal zone B cells and regulates differentiation of dendritic cells (DCs) in the spleen. Notch2 appears to play some specific roles in the intestinal immunity, given that the fate of mast cells and a subset of DCs is regulated by Notch2 in the intestine. Notch2 also has important roles in helper T cell divergence from naïve CD4 T cells and activation of cytotoxic T cells (PMID: 22695918).

Loading...
||
New chat Able
正在加载,请稍候...