NOTCH2/NOTCH2NL Monoclonal antibody, PBS Only

• 

  WB analysis of hTERT-RPE1 using 68212-1-Ig (same clone as 68212-1-PBS)

  hTERT-RPE1 cells were subjected to SDS PAGE followed by western blot with 68212-1-Ig (NOTCH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68212-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-87 MG using 68212-1-Ig (same clone as 68212-1-PBS)

  U-87 MG cells were subjected to SDS PAGE followed by western blot with 68212-1-Ig (NOTCH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68212-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68212-1-Ig (same clone as 68212-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NOTCH2/NOTCH2NL antibody (68212-1-Ig, Clone: 2D5E1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68212-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68212-1-Ig (same clone as 68212-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NOTCH2/NOTCH2NL antibody (68212-1-Ig, Clone: 2D5E1 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68212-1-PBS in a different storage buffer formulation.

NOTCH2/NOTCH2NL Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68212-1-PBS

Clone No.2D5E1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

NOTCH2NL, NOTCH2NLC, NOTCH2, Notch homolog 2 N-terminal-like protein C, N2N

---

Product Information

68212-1-PBS targets NOTCH2/NOTCH2NL in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1679

  Product name: Recombinant human NOTCH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-254 aa of BC019835

  Sequence: PAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

• Full Name: Notch homolog 2 (Drosophila) N-terminal like
• Calculated Molecular Weight: 265 kDa
• Observed Molecular Weight: 250-265 kDa
• GenBank Accession Number: BC019835
• Gene Symbol: NOTCH2NL
• Gene ID (NCBI): 388677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P0DPK4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Notch 2 is a member of the notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. Notch2, like other Norch genes, functions in development of various tissues. This antibody can recognize NOTCH2 and NOTCH2NL. The antibody detects the full-length NOTCH2 protein about 250-265 kDa.