NOTUM Monoclonal antibody

• Home
• Products
• Primary Antibodies
• NOTUM Monoclonal antibody (66956-1-Ig)

NOTUM Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66956-1-Ig Copied!

Clone No. 2F6D5

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

2F6D5, EC:3.1.1.98, hNOTUM, OK/SW-CL.30, Palmitoleoyl-protein carboxylesterase NOTUM

• 

  WB analysis using 66956-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66956-1-Ig (NOTUM antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 66956-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66956-1-Ig (NOTUM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 66956-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66956-1-Ig (NOTUM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of T-47D using 66956-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 66956-1-Ig (NOTUM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 66956-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66956-1-Ig (NOTUM antibody) at dilution of 1:5000 (under 10x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 66956-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66956-1-Ig (NOTUM antibody) at dilution of 1:5000 (under 40x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NOTUM in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HepG2 cells, T-47D cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66956-1-Ig targets NOTUM in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6338

  Product name: Recombinant human NOTUM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 76-430 aa of BC060882

  Sequence: TMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS

• Full Name: notum pectinacetylesterase homolog (Drosophila)
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC060882
• Gene Symbol: NOTUM
• Gene ID (NCBI): 147111
• RRID: AB_2882279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6P988
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NOTUM Monoclonal antibody (Cat# 66956-1-Ig) has 3 total citations. These appear in Nature Communications (2025), Current Research in Microbial Sciences (2026), and iScience (2026). The associated research fields include intestinal stem cell aging and lipoic acid function in Paneth cells, Wnt/β-catenin signaling in influenza virus replication, and hepatocellular carcinoma progression via the STRAP/Wnt-β-catenin feedback loop.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Lipoic acid functions in Paneth cells to prevent human intestinal stem cell aging.; Authors - Zehong Zhang
human	WB	Curr Res Microb Sci; The lncRNA GAS5-encoded micropeptide facilitates influenza virus replication through modulation of the Wnt/β-catenin signaling pathway.; Authors - Xinni Zhou
		iScience; STRAP promotes hepatocellular carcinoma progression through activation of an STRAP/Wnt-β-catenin/STRAP positive feedback loop.; Authors - Chunxun Liu