Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | Human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17772-1-AP targets NOX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12187 Product name: Recombinant human NOX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 292-560 aa of BC075014 Sequence: QQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN Predict reactive species |
| Full Name | NADPH oxidase 1 |
| Calculated Molecular Weight | 564 aa, 65 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC075014 |
| Gene Symbol | NOX1 |
| Gene ID (NCBI) | 27035 |
| RRID | AB_2833043 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5S8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NNOX1(NADPH oxidase 1) is also named as MOX1, NOH1 and belongs to the reactive oxygen species (ROS)-generating NADPH oxidase family. It plays a role in host defense, cell growth and differentiation, cell migration, and malignant transformation(PMID:20351171). It also can mediate oncogenic Ras-induced upregulation of VEGF and angiogenesis by activating Sp1 through Ras-ERK-dependent phosphorylation of Sp1(PMID:18454179). It has 3 isoforms produced by alternative splicing with the molecular weight of 65 kDa, 22 kDa and 59 kDa. The full length protein has two glycosylation sites. It always can be detected two bands of 63 kDa and 55 kDa in cells by western blot or another lower band of 45 kDa which is not likely due to alternative translation or splice variation, but as adjustment for the signal peptide and tag removal(PMID:17560373) or unspecifc(PMID:17460729).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NOX1 antibody 17772-1-AP | Download protocol |
| WB protocol for NOX1 antibody 17772-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
NOX1 Polyclonal antibody (Cat# 17772-1-AP) has accumulated 93 citations published in journals including Circulation, Nature Communications, Nature Microbiology, Molecular Cell, Redox Biology, Free Radical Biology and Medicine, Advanced Science, Cell Death Discovery, and Antioxidants. The associated research fields encompass cardiovascular disease (atherosclerosis, aneurysm, hypertension), oxidative stress, ferroptosis, inflammation, cancer, neurodegeneration, diabetic complications, bone metabolism, and wound healing.
| Species | Application | Title |
|---|---|---|
Circulation Megakaryocytic Leukemia 1 (MKL1) Bridges Epigenetic Activation of NADPH Oxidase in Macrophages to Cardiac Ischemia-Reperfusion Injury. | ||
Nat Microbiol Nanozymes modulate probiotic tryptophan metabolism to prevent Salmonella infection in mammalian models. | ||
Nat Commun IL-17RA signaling promotes the dedifferentiation of Paneth progenitors through ADAM17 to regenerate gut epithelium post-irradiation. | ||
Redox Biol Deficiency of S100 calcium binding protein A9 attenuates vascular dysfunction in aged mice | ||
Redox Biol Coronin 1a-mediated F-actin disassembly controls effector function in murine neutrophils | ||
Redox Biol p47phox deficiency impairs platelet function and protects mice against arterial and venous thrombosis. |
Reviews
What customers say
One reviewer rated this antibody 5/5 stars, reporting excellent performance in Western Blot at a 1:1000 dilution on both colon tissue samples and colon cell lines (Caco-2 and HT-29). The user found it worked very well for their applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Balawant (Verified Customer) (08-23-2022) | I have used this antibody for colon tissue sample and colon cell line like caco2 cells, HT29 cells , it is working excellent.
|
