Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, HEK-293 cells, JAR cells, mouse kidney tissue, mouse lung tissue, U-118 MG cells, U-251 cells, U-87 MG cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14347-1-AP targets NOX4 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5687 Product name: Recombinant human NOX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 224-578 aa of BC040105 Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS Predict reactive species |
| Full Name | NADPH oxidase 4 |
| Calculated Molecular Weight | 67 kDa |
| Observed Molecular Weight | 58-67 kDa |
| GenBank Accession Number | BC040105 |
| Gene Symbol | NOX4 |
| Gene ID (NCBI) | 50507 |
| RRID | AB_10638146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPH5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage. (PMID: 11728818, PMID: 29285262, PMID: 14670934)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NOX4 antibody 14347-1-AP | Download protocol |
| WB protocol for NOX4 antibody 14347-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NOX4 antibody (catalog 14347-1-AP) has 440 total citations. These appear in high-impact journals including Circulation, Immunity, Nature Communications, Autophagy, Redox Biology, Free Radical Biology and Medicine, Antioxidants, Oxidative Medicine and Cellular Longevity, Cell Death & Disease, and Pharmacological Research. Research fields span oxidative stress/ROS signaling, cardiovascular disease, diabetic nephropathy and cardiomyopathy, cancer, neurodegeneration, ferroptosis, and inflammation. Most applications are Western blot, with some IF, IHC, and CoIP.
| Species | Application | Title |
|---|---|---|
Circulation Megakaryocytic Leukemia 1 (MKL1) Bridges Epigenetic Activation of NADPH Oxidase in Macrophages to Cardiac Ischemia-Reperfusion Injury. | ||
Nat Commun Spatial oxidation of L-plastin downmodulates actin-based functions of tumor cells. | ||
Nat Commun Elevating cytosolic NADPH metabolism in endothelial cells ameliorates vascular aging. | ||
Exp Mol Med A novel PPARɣ ligand, PPZ023, overcomes radioresistance via ER stress and cell death in human non-small-cell lung cancer cells. |
Reviews
What customers say
The single review for this antibody reports a 5-star rating for Western Blot. The user found that the antibody produced clear, well-defined bands at a 1:1000 dilution using 5% BSA in TBST as the blocking/buffer system, tested on HeLa cells. Overall, the feedback is positive, highlighting strong performance and crisp banding at a relatively low dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
K (Verified Customer) (02-02-2022) | This antibody gave us really nice bands in 1:1000 dilution with 5% BSA+TBST.
|
