NPEPPS Recombinant monoclonal antibody

• 

  WB analysis using 84230-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84230-2-RR (NPEPPS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 84230-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using NPEPPS antibody (84230-2-RR, Clone: 241502G8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84230-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84230-2-RR against Human NPEPPS were performed. The affinity constant is below 1 pM.

NPEPPS Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84230-2-RR

Clone No.241502G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

PSA, MP100, AAP S, 241502G8

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293T cells, MDCK cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84230-2-RR targets NPEPPS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36035

  Product name: Recombinant human NPEPPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-919 aa of BC065294

  Sequence: GKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV

• Full Name: aminopeptidase puromycin sensitive
• Observed Molecular Weight: 103 kDa
• GenBank Accession Number: BC065294
• Gene Symbol: NPEPPS
• Gene ID (NCBI): 9520
• RRID: AB_3671782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55786
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPEPPS, also known as PSA, is a member of the oxytocinase subfamily of the M1 aminopeptidase family. NPEPPS encodes puromycin-sensitive aminopeptidase, a zinc metallopeptidase that hydrolyzes amino acids from the N-terminus of its substrate. The protein has 2 isoforms and is located in the cytoplasm.