NPEPPS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84230-4-RR (same clone as 84230-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84230-4-RR (NPEPPS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84230-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84230-4-RR (same clone as 84230-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84230-4-RR (NPEPPS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84230-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84230-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84230-4-RR against Human NPEPPS were performed. The affinity constant is 0.956 nM.

NPEPPS Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84230-4-PBS

Clone No.241502G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PSA, MP100, AAP S, 241502G5

---

Product Information

84230-4-PBS targets NPEPPS in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36035

  Product name: Recombinant human NPEPPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-919 aa of BC065294

  Sequence: GKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV

• Full Name: aminopeptidase puromycin sensitive
• Observed Molecular Weight: 103 kDa
• GenBank Accession Number: BC065294
• Gene Symbol: NPEPPS
• Gene ID (NCBI): 9520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P55786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NPEPPS, also known as PSA, is a member of the oxytocinase subfamily of the M1 aminopeptidase family. NPEPPS encodes puromycin-sensitive aminopeptidase, a zinc metallopeptidase that hydrolyzes amino acids from the N-terminus of its substrate. The protein has 2 isoforms and is located in the cytoplasm.