Product Information
23415-1-PBS targets NPFFR1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20057 Product name: Recombinant human NPFFR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 339-430 aa of BC131580 Sequence: GFQAAFRARLCPRPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSHLPLTIPAWDI Predict reactive species |
| Full Name | neuropeptide FF receptor 1 |
| Calculated Molecular Weight | 430 aa, 48 kDa |
| Observed Molecular Weight | 48-50 kDa |
| GenBank Accession Number | BC131580 |
| Gene Symbol | NPFFR1 |
| Gene ID (NCBI) | 64106 |
| RRID | AB_3742086 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9GZQ6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NPFFR1 (Neuropeptide FF Receptor 1) is primarily focused on its role in various physiological and pathological processes. NPFFR1 is involved in modulating the effects of opioids, including their analgesic properties and side effects. This interaction has led to research into the potential use of NPFFR1 ligands to enhance opioid efficacy and reduce adverse effects (PMID: 32673481). Research suggests that NPFFR1 may have neuroprotective effects, particularly in the context of stroke recovery. It may promote neuronal survival, axonal growth, and reduce inflammation (PMID: 39519132).
