Filter: AllIHC

IHC staining of mouse testis using 25971-1-AP (same clone as 25971-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25971-1-AP (NPHP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25971-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 25971-1-AP (same clone as 25971-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25971-1-AP (NPHP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25971-1-PBS in a different storage buffer formulation.

NPHP1 Polyclonal antibody, PBS Only

Name: NPHP1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25971-1-PBS

NPHP1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25971-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

25971-1-PBS targets NPHP1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22965 Product name: Recombinant human NPHP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-48 aa of BC062574 Sequence: MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQR Predict reactive species
Full Name	nephronophthisis 1 (juvenile)
Calculated Molecular Weight	83 kDa
GenBank Accession Number	BC062574
Gene Symbol	NPHP1
Gene ID (NCBI)	4867
RRID	AB_3669514
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O15259
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™