NPM3 Polyclonal antibody

• 

  WB analysis using 11960-1-AP

  Hela lysates were subjected to SDS PAGE followed by western blot with 11960-1-AP (NPM3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11960-1-AP

  IP result of anti-NPM3 (IP:11960-1-AP, 4ug; Detection:11960-1-AP 1:500) with HeLa cells lysate 3400ug.

• 

  IHC staining of human lymphoma using 11960-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11960-1-AP (NPM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 11960-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11960-1-AP (NPM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11960-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 11960-1-AP (NPM3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

NPM3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11960-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TMEM123, PORMIN, Nucleoplasmin-3, Nucleoplasmin 3, nucleophosmin/nucleoplasmin, 3

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11960-1-AP targets NPM3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2564

  Product name: Recombinant human NPM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC054868

  Sequence: MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP

• Full Name: nucleophosmin/nucleoplasmin, 3
• Calculated Molecular Weight: 178 aa, 19 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC054868
• Gene Symbol: NPM3
• Gene ID (NCBI): 10360
• RRID: AB_874199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75607
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPM3, a member of the nucleophosmin/ nucleoplasmin family, lacks intrinsic histone chaperone activity, inhibits histone assembly activity of NPM1 in vitro, and dramatically enhances transcription in a cellular system(PMID: 20073534). Human NPM3 is an abundant and widely expressed protein with primarily nuclear localization. The NPM3 protein migrated in SDS-PAGE gels as a doublet with apparent molecular masses of 25 and 27 kDa, which are larger than the 20.5 kDa mass predicted by the deduced amino acid sequence including the HA tag (PMID: 11722795). The NPM3 antibody can detect two bands with MW between 20-27 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Life Sci Alliance; The nucleolar phase of signal recognition particle assembly; Authors - Amani Issa
human	WB	Sci Rep; Characterization of the AGR2-NPM3 axis uncovers the AGR2 involvement in PD-L1 regulation in colorectal cancer; Authors - Andrea Martisova
human	WB,IHC,IF	Cancer Lett; Pumilio1 regulates NPM3/NPM1 axis to promote PD-L1-mediated immune escape in gastric cancer; Authors - Han Wang