NPM3 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 85156-5-RR (same clone as 85156-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NPM3 antibody (85156-5-RR, Clone: 242863G12 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85156-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85156-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85156-5-RR against Human NPM3 were performed. The affinity constant is 1.98 nM.

NPM3 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 85156-5-PBS

Clone No.242863G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

242863G12, nucleophosmin/nucleoplasmin, 3, Nucleoplasmin 3, Nucleoplasmin-3, PORMIN

---

Product Information

85156-5-PBS targets NPM3 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2564

  Product name: Recombinant human NPM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC054868

  Sequence: MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP

• Full Name: nucleophosmin/nucleoplasmin, 3
• Calculated Molecular Weight: 178 aa, 19 kDa
• GenBank Accession Number: BC054868
• Gene Symbol: NPM3
• Gene ID (NCBI): 10360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75607
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NPM3, a member of the nucleophosmin/ nucleoplasmin family, lacks intrinsic histone chaperone activity, inhibits histone assembly activity of NPM1 in vitro, and dramatically enhances transcription in a cellular system(PMID: 20073534). Human NPM3 is an abundant and widely expressed protein with primarily nuclear localization. The NPM3 protein migrated in SDS-PAGE gels as a doublet with apparent molecular masses of 25 and 27 kDa, which are larger than the 20.5 kDa mass predicted by the deduced amino acid sequence including the HA tag (PMID: 11722795).