NPR1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NPR1 Recombinant monoclonal antibody (87831-1-RR)

• 

  WB analysis using 87831-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87831-1-RR (Npr1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87831-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87831-1-RR against Mouse NPR1 were performed. The affinity constant is 0.126 nM.

NPR1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87831-1-RR

Clone No.251242G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

ANP-A, ANPR-A, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor type A, EC:4.6.1.2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, mouse lung tissue, mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87831-1-RR targets NPR1 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2985

  Product name: recombinant mouse Npr1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 29-469 aa of NM_008727.5

  Sequence: SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE

• Full Name: natriuretic peptide receptor 1
• Calculated Molecular Weight: 119 kDa
• Observed Molecular Weight: 119-140 kDa
• GenBank Accession Number: NM_008727.5
• Gene Symbol: Npr1
• Gene ID (NCBI): 18160
• RRID: AB_3745775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18293
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPR1(Atrial natriuretic peptide receptor 1), also named as NPRA , is a transmembrane protein expressed in the vascular endothelium. Activation of NPRA requires a binding of natriuretic peptides NPPA (ANP) or NPPB (BNP) to its extracellular domain and this promotes the production of cyclic guanosine monophosphate (cGMP), which in turn activates protein kinase cGMP‐dependent 1 (PRKG1 or commonly used as PKG).