NPRC/NPR3 Polyclonal antibody

• 

  IHC staining of human kidney using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver cancer using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NPRC/NPR3 Polyclonal Antibody for IHC, ELISA

Cat No. 26706-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF, ELISA

Synonyms

NPR3, ANP C, ANP-C, ANPR C, ANPRC

---

Tested Applications

• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26706-1-AP targets NPRC/NPR3 in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19071

  Product name: Recombinant human NPR3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 48-378 aa of BC131540

  Sequence: LPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRA

• Full Name: natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
• Calculated Molecular Weight: 541 aa, 60 kDa
• GenBank Accession Number: BC131540
• Gene Symbol: NPR3
• Gene ID (NCBI): 4883
• RRID: AB_2880607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17342
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), also known as NPR3, is an atrial natriuretic peptide receptor. The family of natriuretic peptides elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. NPR3 has 3 isoforms with MWs of 37~60 kDa produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Sci Rep; A novel immune score model predicting the prognosis and immunotherapy response of breast cancer; Authors - Wenchang Lv