NPRC/NPR3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NPRC/NPR3 Polyclonal antibody (26706-1-AP)

NPRC/NPR3 Polyclonal Antibody for IHC, ELISA

Cat No. 26706-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

NPR3, ANP C, ANP-C, ANPR C, ANPRC

• 

  IHC staining of human kidney using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26706-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26706-1-AP (NPRC/NPR3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NPRC/NPR3 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26706-1-AP targets NPRC/NPR3 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19071

  Product name: Recombinant human NPR3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 48-378 aa of BC131540

  Sequence: LPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRA

• Full Name: natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
• Calculated Molecular Weight: 541 aa, 60 kDa
• GenBank Accession Number: BC131540
• Gene Symbol: NPR3
• Gene ID (NCBI): 4883
• RRID: AB_2880607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17342
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), also known as NPR3, is an atrial natriuretic peptide receptor. The family of natriuretic peptides elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. NPR3 has 3 isoforms with MWs of 37~60 kDa produced by alternative splicing.

Publications

What published studies show

The NPRC/NPR3 Polyclonal antibody (Cat# 26706-1-AP) has 3 citations published in Annals of Medicine, Scientific Reports, and Journal of Inflammation Research. The associated research fields include renal cell carcinoma prognostic classification and bioinformatic analysis, breast cancer immune scoring for predicting immunotherapy response, and pan-cancer analysis of NPR3 with clinical cohort validation. All citations involve human samples using IHC, WB, or IF applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	Sci Rep; A novel immune score model predicting the prognosis and immunotherapy response of breast cancer; Authors - Wenchang Lv
human	IHC	Ann Med; Construction and validation of renal cell carcinoma tumor cell differentiation-related prognostic classification (RCC-TCDC): an integrated bioinformatic analysis and clinical study; Authors - Yifan Liu
human	WB,IHC	J Inflamm Res; A Pan-Cancer Analysis of Natriuretic Peptide Receptor 3 (NPR3) with Clinical Cohort and in vitro Validation.; Authors - Yifan Liu ; KD Validated