Product Information
25085-1-PBS targets NPSR1 in IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18785 Product name: Recombinant human NPSR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC132693 Sequence: MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQ Predict reactive species |
| Full Name | neuropeptide S receptor 1 |
| Calculated Molecular Weight | 371 aa, 43 kDa |
| GenBank Accession Number | BC132693 |
| Gene Symbol | NPSR1 |
| Gene ID (NCBI) | 387129 |
| RRID | AB_3742135 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6W5P4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Neuropeptide S receptor 1 (NPSR1), previously known as GPRA and GPR154, is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes. NPSR1 is primarily expressed in the bronchus, brain, and immune cells. It is also found in specific peripheral cell types such as monocytes/macrophages and neuroendocrine cells of the gut (PMID: 30711025).







