NPSR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NPSR1 Polyclonal antibody, PBS Only (25085-1-PBS)

• 

  IHC staining of human colon cancer using 25085-1-AP (same clone as 25085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded colon cancer slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 25085-1-AP (same clone as 25085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 25085-1-AP (same clone as 25085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25085-1-PBS in a different storage buffer formulation.

NPSR1 Polyclonal Antibody for IHC, ELISA

Cat No. 25085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

neuropeptide S receptor 1, Neuropeptide S receptor, GPRA, GPR154, G protein coupled receptor 154

---

Product Information

25085-1-PBS targets NPSR1 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18785

  Product name: Recombinant human NPSR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-52 aa of BC132693

  Sequence: MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQ

• Full Name: neuropeptide S receptor 1
• Calculated Molecular Weight: 371 aa, 43 kDa
• GenBank Accession Number: BC132693
• Gene Symbol: NPSR1
• Gene ID (NCBI): 387129
• RRID: AB_3742135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6W5P4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuropeptide S receptor 1 (NPSR1), previously known as GPRA and GPR154, is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes. NPSR1 is primarily expressed in the bronchus, brain, and immune cells. It is also found in specific peripheral cell types such as monocytes/macrophages and neuroendocrine cells of the gut (PMID: 30711025).